Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Anti-MAP3K1 Antibody Clone 2F6

$ 298.00
Please Select Product Options Below To View The Catalog Number.

SKU: 4214-MSM1
Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Western Blot, Immunohistochemistry (IHC)
Available Conjugates: Unconjugated
Isotype: Mouse IgG2a kappa
Mass Spec Validated?: Not MS Validated

Size
Tag Clear selection
Shipping Information
In Stock: 1-2 Day Lead Time.
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
SKU: 4214-MSM1-P1
MAP3K1 General Information
Alternate Names
Mitogen-activated protein kinase kinase kinase 1, MAP3K1
Molecular Weight
195kDa (intact); 80kDa (cleaved)
Chromosomal Location
5q11.2
Curated Database and Bioinformatic Data
Gene SymbolMAP3K1
Entrez Gene ID4214
Ensemble Gene IDENSG00000095015
RefSeq Protein Accession(s)NP_005912, XP_016864974, XP_016864973
RefSeq mRNA Accession(s)NM_005921, XM_017009485, XR_001742068, XM_017009484,
RefSeq Genomic Accession(s)NC_000005, NC_018916, NG_031884
UniProt ID(s)Q13233
UniGene ID(s)Q13233
HGNC ID(s)6848
Cosmic ID(s)MAP3K1
KEGG Gene ID(s)hsa:4214
PharmGKB ID(s)PA30592
General Description of MAP3K1.
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate, thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK, p38. These activated MEKs in turn phosphorylate, activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4, ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK, c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1, MAP2K4,, also activates the central protein kinases of the NF??B pathway, CHUK, IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Human Anti-MAP3K1 Antibody Product Attributes

Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Western Blot, Immunohistochemistry (IHC).
Application Notes: Flow Cytometry (0.5-1ug of antibody/million cells in 0.1ml), Immunofluorescence (1-2ug of antibody/ml), Western Blot (0.5-1ug of antibody/ml), Immunohistochemistry (IHC) (Formalin-fixed) (0.5-1ug of antibody/ml for 30 minutes at RT)
Clonality: Monoclonal
Anti-MAP3K1 Antibody Clone: 2F6
Clone 2F6 Host and Isotype: Mouse IgG2a kappa
Anti-Human MAP3K1 Positive Control Sample: A431, HeLa or HL-60 cells or liver tissue.
Cellular Localization of Antibody Cytoplasmic
Buffer and Stabilizer: 10mM PBS with 0.05% BSA & 0.05% azide.
Antibody Concentration: 200ug/ml
Antibody Purification Method:Protein A/G Purified
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Storage Conditions: Store at 2 to 8° C (refrigerate). Stable for 24 months when properly stored.

MAP3K1 Previously Observed Antibody Staining Patterns

Observed Subcellular, Organelle Specific Staining Data:

Anti-MAP3K1 antibody staining is expected to be primarily localized to the cytosol.

Observed Antibody Staining Data By Tissue Type:

Variations in MAP3K1 antibody staining intensity in immunohistochemistry on tissue sections are present across different anatomical locations. An intense signal was observed in decidual cells in the placenta, exocrine glandular cells in the pancreas, glandular cells in the adrenal gland, cervix, uterine, colon, duodenum, parathyroid gland and thyroid gland, hepatocytes in liver, macrophages in lung, myocytes in heart muscle, non-germinal center cells in the tonsil and respiratory epithelial cells in the bronchus and nasopharynx. More moderate antibody staining intensity was present in decidual cells in the placenta, exocrine glandular cells in the pancreas, glandular cells in the adrenal gland, cervix, uterine, colon, duodenum, parathyroid gland and thyroid gland, hepatocytes in liver, macrophages in lung, myocytes in heart muscle, non-germinal center cells in the tonsil and respiratory epithelial cells in the bronchus and nasopharynx. Low, but measureable presence of MAP3K1 could be seen inadipocytes in mesenchymal tissue, bile duct cells in the liver, endothelial cells in the cerebral cortex, follicle cells in the ovary, glial cells in the cerebral cortex and hippocampus, myocytes in skeletal muscle, ovarian stroma cells in the ovary, peripheral nerve in mesenchymal tissue, pneumocytes in lung, smooth muscle cells in the smooth muscle and squamous epithelial cells in the oral mucosa. We were unable to detect MAP3K1 in other tissues. Disease states, inflammation, and other physiological changes can have a substantial impact on antibody staining patterns. These measurements were all taken in tissues deemed normal or from patients without known disease.

Observed Antibody Staining Data By Tissue Disease Status:

Tissues from cancer patients, for instance, have their own distinct pattern of MAP3K1 expression as measured by anti-MAP3K1 antibody immunohistochemical staining. The average level of expression by tumor is summarized in the table below. The variability row represents patient to patient variability in IHC staining.

Sample Type breast cancer carcinoid cervical cancer colorectal cancer endometrial cancer glioma head and neck cancer liver cancer lung cancer lymphoma melanoma ovarian cancer pancreatic cancer prostate cancer renal cancer skin cancer stomach cancer testicular cancer thyroid cancer urothelial cancer
Signal Intensity ++ ++ ++ +++ ++ +++ ++ ++ ++ ++ ++ +++ ++ ++ + ++ ++ ++ +++ ++
MAP3K1 Variability ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ ++ + ++

Limitations and Warranty

enQuire Bio's MAP3K1 Anti-Human Monoclonal is available for Research Use Only. This antibody is guaranteed to work for a period of two years when properly stored.

There are no reviews yet.

Be the first to review “Anti-MAP3K1 Antibody Clone 2F6”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif

enQuire Bio, LLC   1825 Lawrence St, Ste 115   Denver, CO 80202
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email
Scroll to top

We consume cookies ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it. Dismiss

Anti-MAP3K1 Antibody Clone 2F6https://enquirebio.com/wp-content/uploads/2017/10/enQuire-Bio-4214-MSM1-P1-anti-MAP3K1-antibody-300x225.jpeghttps://enquirebio.com/wp-content/uploads/2017/11/enQuire-Bio-4214-MSM1-P1-anti-MAP3K1-antibody-1-300x225.jpeg