Porcine Trypsin Bioactive Protein Product Attributes
Product Type: Bioactive Protein
Recombinant Trypsin based upon sequence from Porcine
Host: QP10897 protein expressed in Pichia Pastoris.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Trypsin was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes: Please contact us for application specific information for QP10897.
Bioactivity Data: 3,394 BAEE units/mg powder.
Specific Activity: 3,394 BAEE units/mg powder.
Amino Acid Sequence: VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
Reconstitution Instructions: |||
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The Porcine Trypsin (2.98 mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH 3.
Storage Conditions: Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Physical Appearance: Sterile Filtered clear liquid solution.
Limitations and Performance Guarantee
enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.