Placeholder

Recombinant Porcine Trypsin Protein

$ 89.00$ 900.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10897
Species: Porcine
Applications: Bioactive
Available Tags: Untagged
Available Hosts: Pichia Pastoris
Length (Amino Acids):

Size
Tag Clear selection
Shipping Information
1-3 days
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
SKU: QP10897-1mg

Porcine Trypsin Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant Trypsin based upon sequence from Porcine
Host: QP10897 protein expressed in Pichia Pastoris.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Trypsin was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes: Please contact us for application specific information for QP10897.
Bioactivity Data: 3,394 BAEE units/mg powder.
Specific Activity: 3,394 BAEE units/mg powder.
Amino Acid Sequence: VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
Reconstitution Instructions: |||
Endotoxin Levels:
Buffer: The Porcine Trypsin (2.98 mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH 3.
Storage Conditions: Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Physical Appearance: Sterile Filtered clear liquid solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Porcine Trypsin Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif

enQuire Bio, LLC   1825 Lawrence St, Ste 115   Denver, CO 80202
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-855-344-1400
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email
Scroll to top

We consume cookies ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it. Dismiss

Recombinant Porcine Trypsin Protein