Placeholder

Recombinant Porcine Trypsin Protein

$ 89.00$ 900.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10897
Species: Porcine
Applications: Bioactive
Available Tags: Untagged
Available Hosts: Pichia Pastoris
Length (Amino Acids):

Product NumberDescriptionPrice
QP10897-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 89.00
QP10897-2.5mg Size: 2.5 mg, Tag: Untagged (Native Protein) $ 130.00
QP10897-50mg Size: 50 mg, Tag: Untagged (Native Protein) $ 900.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10897-1mg

Porcine Trypsin Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant Trypsin based upon sequence from Porcine
Host: QP10897 protein expressed in Pichia Pastoris.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Trypsin was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes: Please contact us for application specific information for QP10897.
Bioactivity Data: 3,394 BAEE units/mg powder.
Specific Activity: 3,394 BAEE units/mg powder.
Amino Acid Sequence: VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
Reconstitution Instructions: |||
Endotoxin Levels:
Buffer: The Porcine Trypsin (2.98 mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH 3.
Storage Conditions: Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Physical Appearance: Sterile Filtered clear liquid solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Porcine Trypsin Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Porcine Trypsin Protein