enQuire Bio » Products » Recombinant Protein » Recombinant Human Cathepsin B / CTSB Protein
SDS-PAGE separation of QP8562 followed by commassie total protein stain results in a primary band consistent with reported data for Cathepsin B / CTSB. These data demonstrate Greater than 90% as determined by SDS-PAGE.

Recombinant Human Cathepsin B / CTSB Protein

Please Select Product Options Below To View The Catalog Number.

SKU: QP8562
Species: Human
Available Tags: GST
Host: E. coli
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 252

Product NumberDescriptionPrice
Shipping Information
On Demand Protein: 3-5 Week Lead Time. (Why?)
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP8562-ec-10ug
Recombinant Human Cathepsin B / CTSB Protein General Information
Alternate Names
Cathepsin B; CTSB; CPSB; APPS
Curated Database and Bioinformatic Data
Gene Symbol CTSB
Entrez Gene ID 1508
Ensemble Gene ID ENSG00000164733
RefSeq Protein Accession(s) NP_001899.1
RefSeq mRNA Accession(s) NM_001908.4, NM_147780.3, NM_147781.3, NM_147782.3, NM_147783.3, XM_006716244.2, XM_006716245.2, XM_011543812.2, XM_017013097.1, XM_017013098.1, XM_017013099.1, XM_017013100.1
UniProt ID(s) P07858
UniGene ID(s) Hs.520898
HGNC ID(s) HGNC:2527
COSMIC ID Link(s) CTSB
KEGG Gene ID(s) hsa:1508
PharmGKB ID(s) PA27027
General Description of Recombinant Human Cathepsin B / CTSB Protein.
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Human Cathepsin B / CTSB Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Cathepsin B / CTSB based upon sequence from: Human
Host: QP8562 protein expressed in E. coli.
Tag: GST
Protein Construction: A DNA sequence encoding the Homo sapiens (Human) Cathepsin B / CTSB, was expressed in the hosts and tags indicated. Please select your host/tag option, above.
Application Notes: Please contact us for application specific information for QP8562.
Bioactivity Data: Untested
Full Length? Partial (see sequence information for more details).
Expression Region: Ala82 - Asp333
Amino Acid Sequence: ASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions:
Concentration of Human Cathepsin B / CTSB Protein:
Endotoxin Levels: Not determined.
Buffer: Tris-based buffer, 50% glycerol
Storage Conditions: Store at -20C to -80C.

Limitations and Performance Guarantee

This is a life science research product (for Research Use Only). This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human Cathepsin B / CTSB Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes

  protocol submission gif

Related Products

    -
    enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
    Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
    Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

    Recombinant Human Cathepsin B / CTSB Protein