Human Peptide YY Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant Peptide YY based upon sequence from: Human
Host: QP8740 protein expressed in E. coli.
Tag: GST
Protein Construction: A DNA sequence encoding the Homo sapiens (Human) Peptide YY, was expressed in the hosts and tags indicated. Please select your host/tag option, above.
Application Notes: Please contact us for application specific information for QP8740.
Bioactivity Data: Untested
Full Length? Updated: Partial
Expression Region: Updated: Ile31 – Tyr64
Amino Acid Sequence: Updated: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions:
Concentration of Human Peptide YY Protein:
Endotoxin Levels: Not determined.
Buffer: Tris-based buffer, 50% glycerol
Storage Conditions: Store at -20C to -80C.
Recombinant Human Peptide YY Protein (34-70aa) General Information | |
---|---|
Alternate Names | |
PYY1; PYY-I | |
Curated Database and Bioinformatic Data | |
Gene Symbol | PYY |
Entrez Gene ID | 5697 |
Ensemble Gene ID | ENSG00000131096 |
RefSeq Protein Accession(s) | NP_004151.3 |
RefSeq mRNA Accession(s) | NM_004160.5, XM_011525035.1 |
UniProt ID(s) | P10082 |
UniGene ID(s) | Hs.169249 |
HGNC ID(s) | HGNC:9748 |
COSMIC ID Link(s) | PYY |
KEGG Gene ID(s) | hsa:5697 |
PharmGKB ID(s) | PA34090 |
General Description of Recombinant Human Peptide YY Protein (34-70aa). | |
This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. |
Limitations and Performance Guarantee
This is a life science research product (for Research Use Only). This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Reviews
There are no reviews yet.