other Der P1 Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant Der P1 based upon sequence from other
Host: QP11657 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Der P1 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP11657.
Bioactivity Data: Untested
Amino Acid Sequence: MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH
Purity: Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: (1 mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.
Storage Conditions: Der-P1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Colorless Liquid
| Recombinant other Der P1 General Information | |
|---|---|
| Alternate Names | |
| Peptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1. | |
| Molecular Weight | |
| 36.1 kDa | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | DERP1 |
| UniProt ID(s) | P08176 |
| COSMIC ID Link(s) | DERP1 |
| General Description of Recombinant other Der P1. | |
| The E. Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (AA 20-320) and fused to a 6 His Tag at C-terminus, having a total MW of 34.5kDa, pI 5.6. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.