Placeholder

Recombinant HPV HPV 18 Protein

$ 150.00$ 1,200.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP12308
Species: HPV
Applications: See Application Notes
Available Tags: GST
Available Hosts: E. Coli
Purity: Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Length (Amino Acids):

Product NumberDescriptionPrice
QP12308-100ug Size: 100 ug, Tag: GST $ 150.00
QP12308-500ug Size: 500 ug, Tag: GST $ 600.00
QP12308-1mg Size: 1 mg, Tag: GST $ 1,200.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP12308-100ug

HPV HPV 18 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HPV 18 based upon sequence from HPV
Host: QP12308 protein expressed in E. Coli.
Available Tags: GST
Protein Construction: A cDNA sequence encoding the sequence of HPV 18 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP12308.
Bioactivity Data: Untested
Amino Acid Sequence: VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Purity: Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Physical Appearance: Sterile filtered clear liquid formulation.

Limitations and Performance Guarantee

enQuire Bios products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant HPV HPV 18 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant HPV HPV 18 Protein