Recombinant Helicobacter Pylori Omp Pylori Protein

Price range: $ 150.00 through $ 1,200.00

SKU: QP12926
Species: Helicobacter Pylori
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Length (Amino Acids):

 PDF Datasheet

Helicobacter Pylori Omp Pylori Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Omp Pylori based upon sequence from Helicobacter Pylori
Host: QP12926 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Omp Pylori was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP12926.
Bioactivity Data: Untested
Amino Acid Sequence: MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL
Purity: Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Storage Conditions: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile filtered liquid formulation.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Helicobacter Pylori Omp Pylori Protein