Human PON2 Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant PON2 based upon sequence from Human
Host: QP13110 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PON2 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13110.
Bioactivity Data: Untested
Amino Acid Sequence: MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Purity: Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: PON2 is supplied in PBS and 50% glycerol.
Storage Conditions: Store at 4°C if entire vial will be used within 1-2 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered clear solution.
| Recombinant Human PON2 General Information | |
|---|---|
| Alternate Names | |
| Serum paraoxonase, arylesterase 2, EC 3.1. 1.2, EC 3.1. 8.1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2. | |
| Molecular Weight | |
| 43.5 kDa | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | Q15165 |
| General Description of Recombinant Human PON2. | |
| Human Paraoxonase-2 is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag. The PON2 purified by using an optimized multi-step FPLC method for maximum separation from contaminants. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.