Placeholder

Recombinant Human PON2 Protein

$ 89.00$ 4,800.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13110
Species: Human
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13110-2ug Size: 2 ug, Tag: His $ 89.00
QP13110-10ug Size: 10 ug, Tag: His $ 130.00
QP13110-1mg Size: 1 mg, Tag: His $ 4,800.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13110-2ug
Recombinant Human PON2 General Information
Alternate Names
Serum paraoxonase, arylesterase 2, EC 3.1. 1.2, EC 3.1. 8.1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2.
Molecular Weight
43.5 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)Q15165
General Description of Recombinant Human PON2.
Human Paraoxonase-2 is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag. The PON2 purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human PON2 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant PON2 based upon sequence from Human
Host: QP13110 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PON2 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13110.
Bioactivity Data: Untested
Amino Acid Sequence: MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Purity: Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: PON2 is supplied in PBS and 50% glycerol.
Storage Conditions: Store at 4°C if entire vial will be used within 1-2 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human PON2 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human PON2 Protein