Placeholder

Recombinant Human PROC Protein

$ 89.00$ 1,100.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13151
Species: Human
Applications: See Application Notes
Available Tags: His
Available Hosts: HEK 293
Purity: Greater than 80.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13151-2ug Size: 2 ug, Tag: His $ 89.00
QP13151-10ug Size: 10 ug, Tag: His $ 130.00
QP13151-100ug Size: 100 ug, Tag: His $ 1,100.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13151-2ug
Recombinant Human PROC General Information
PROC  protein 3D structural model from Catalog of Somatic Mutations in Cancer originally published in the paper COSMIC: somatic cancer genetics at high-resolution
Alternate Names
Vitamin K-dependent protein C, Anticoagulant protein C, Autoprothrombin IIA, Blood coagulation factor XIV, PROC, PC, APC, PROC1, THPH3, THPH4.
Molecular Weight
72 kDa
Chromosomal Location
q14.3 on chromosome 2
Curated Database and Bioinformatic Data
Gene SymbolPROC
Entrez Gene ID5624
UniProt ID(s)P04070
COSMIC ID Link(s)PROC
KEGG Gene ID(s)hsa:5624
General Description of Recombinant Human PROC.
Human PROC full length protein (33-461 aa) produced in HEK 293 cells with a C-terminal His-tag, having a molecular weight of 72kDa. Human PROC is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human PROC Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant PROC based upon sequence from Human
Host: QP13151 protein expressed in HEK 293.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PROC was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13151.
Bioactivity Data: Untested
Amino Acid Sequence: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHHThe first 32 amino acids are predicted as signal peptide
Purity: Greater than 80.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Physical Appearance: Sterile Filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human PROC Protein”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human PROC Protein