Placeholder

Recombinant Human RAC1 Protein

$ 89.00$ 1,800.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13249
Species: Human
Applications: See Application Notes
Available Tags: Untagged, His
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13249-10ug Size: 10 ug, Tag: Untagged (Native Protein) $ 89.00
QP13249-HIS-10ug Size: 10 ug, Tag: His $ 89.00
QP13249-50ug Size: 50 ug, Tag: Untagged (Native Protein) $ 130.00
QP13249-HIS-50ug Size: 50 ug, Tag: His $ 130.00
QP13249-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 1,800.00
QP13249-HIS-1mg Size: 1 mg, Tag: His $ 1,800.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13249-10ug
Recombinant Human RAC1 General Information
Alternate Names
P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Molecular Weight
21.4 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)P63000
General Description of Recombinant Human RAC1.
Human RAC1 produced in E. Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.

Human RAC1 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant RAC1 based upon sequence from Human
Host: QP13249 protein expressed in E. Coli.
Available Tags: Untagged, His
Protein Construction: A cDNA sequence encoding the sequence of RAC1 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13249.
Bioactivity Data: Untested
Amino Acid Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Purity: Greater than 95.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered colorless solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human RAC1 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human RAC1 Protein