Placeholder

Recombinant Human SYK Protein

$ 89.00$ 1,000.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13656
Species: Human
Applications: See Application Notes
Available Tags: Flag Tag
Available Hosts: HEK 293
Purity: Greater than 85.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13656-2ug Size: 2 ug $ 89.00
QP13656-10ug Size: 10 ug $ 130.00
QP13656-100ug Size: 100 ug $ 1,000.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13656-2ug
Recombinant Human SYK General Information
SYK  protein 3D structural model from Catalog of Somatic Mutations in Cancer originally published in the paper COSMIC: somatic cancer genetics at high-resolution
Alternate Names
Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK.
Molecular Weight
74.25 kDa
Chromosomal Location
q22.2 on chromosome 9
Curated Database and Bioinformatic Data
Gene SymbolSYK
Entrez Gene ID6850
UniProt ID(s)P43405
COSMIC ID Link(s)SYK
KEGG Gene ID(s)hsa:6850
General Description of Recombinant Human SYK.
Human SYK full length protein (1-635 aa) produced in HEK 293 cells with an N-terminal His-Flag tag, having a molecular weight of 74.25kDa. Human SYK is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human SYK Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant SYK based upon sequence from Human
Host: QP13656 protein expressed in HEK 293.
Available Tags: Flag Tag
Protein Construction: A cDNA sequence encoding the sequence of SYK was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13656.
Bioactivity Data: Untested
Amino Acid Sequence: MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
Purity: Greater than 85.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Physical Appearance: Sterile filtered colorless solution.

Limitations and Performance Guarantee

enQuire Bio's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human SYK Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human SYK Protein