Placeholder

Recombinant Rat Tpc1808 Protein

$ 89.00$ 1,800.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13791
Species: Rat
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13791-10ug Size: 10 ug, Tag: His $ 89.00
QP13791-50ug Size: 50 ug, Tag: His $ 130.00
QP13791-1mg Size: 1 mg, Tag: His $ 1,800.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13791-10ug
Recombinant Rat Tpc1808 General Information
Alternate Names
Tropic 1808, Tpc1808.
Molecular Weight
29.1 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)Q9R0C2
General Description of Recombinant Rat Tpc1808.
Rat Tropic-1808 protein fused to N-terminal His-Tag produced in E. Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. The Tpc1808 is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Rat Tpc1808 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Tpc1808 based upon sequence from Rat
Host: QP13791 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Tpc1808 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13791.
Bioactivity Data: Untested
Amino Acid Sequence: MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Reconstitution Instructions: Please Request a COA for your specific lot for reconstitution instructions. COAs are also included in the package when shipped.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Storage Conditions: Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Rat Tpc1808 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Rat Tpc1808 Protein