Placeholder

Recombinant Rabbit VCAM1 Protein

$ 98.00$ 1,118.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13929
Species: Rabbit
Applications: See Application Notes
Available Tags: His
Available Hosts: Insect
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13929-2ug Size: 2 ug, Tag: His $ 89.00
QP13929-10ug Size: 10 ug, Tag: His $ 130.00
QP13929-0.1mg Size: 0.1 mg, Tag: His $ 1,000.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13929-2ug
Recombinant Rabbit VCAM1 General Information
Alternate Names
Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333.
Molecular Weight
81.8 kDa
Chromosomal Location
On chromosome 13
Curated Database and Bioinformatic Data
Gene SymbolVCAM-1
Entrez Gene ID100008901
UniProt ID(s)Q865F2
COSMIC ID Link(s)VCAM-1
KEGG Gene ID(s)ocu:100008901
General Description of Recombinant Rabbit VCAM1.
VCAM1 Rabbit Recombinant is expressed in insect cells and containing 674 amino acids (AA 25-698) fused to a N-terminal hexahistidine tag, having a total MW of 77.06kDa.

Rabbit VCAM1 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant VCAM1 based upon sequence from Rabbit
Host: QP13929 protein expressed in Insect.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of VCAM1 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13929.
Bioactivity Data: Untested
Amino Acid Sequence: AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENE HSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLM KKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVIS VNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTLIAMRMEDSGIYVCEG VNQIGKSRKEVELIVQEKPFTVEISPGPRIAAQIGDPVVLTCSVRGCETPSFSWRTQIDSPLNGQVT SEGTKSLLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIELSGPPVNGRPVTVSCKVP NVYPFDXLEIELLKGETMMKNKEFLEEEDKKSLETKSLEMTFIPTMEDTGKVLVCQAKLHIDEMEF EPKQRQSTQPLFVNVAPRDIAVWVSPSSIVEEGRSVNMTCSSYGLPAPKILWSRQLKNGDLQPLS ENTTLALISTKLEDSGIYVCEGINLAGKSRKEVELVIQVAPKDIQLTAFPSKSVKEGDTVIISCTCGNV PETWIILKKKAETGDTVLKSIDGAYTIRKAQLEDAGVYECESKNEVGSQLRSITLDVKGRENSKDYF SPE
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The VCAM1 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered colorless solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Rabbit VCAM1 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Rabbit VCAM1 Protein