Recombinant HPV HPV 18 Protein

Price range: $ 150.00 through $ 1,558.00

SKU: QP12308
Species: HPV
Applications: See Application Notes
Available Tags: GST
Available Hosts: E. Coli
Purity: Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Length (Amino Acids):

SKU: QP12308-100ug Categories: , , , , Tag:
 PDF Datasheet

HPV HPV 18 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HPV 18 based upon sequence from HPV
Host: QP12308 protein expressed in E. Coli.
Available Tags: GST
Protein Construction: A cDNA sequence encoding the sequence of HPV 18 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP12308.
Bioactivity Data: Untested
Amino Acid Sequence: VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Purity: Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Physical Appearance: Sterile filtered clear liquid formulation.

Limitations and Performance Guarantee

enQuire Bios products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant HPV HPV 18 Protein