Rabbit IL 8 Recombinant Protein Product Attributes
THIS PRODUCT IS NO LONGER AVAILABLE.
Product Type: Recombinant Protein
Recombinant IL 8 based upon sequence from Rabbit
Host: QP12400 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of IL 8 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP12400.
Bioactivity Data: Untested
Amino Acid Sequence: AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered colorless solution.
| Recombinant Rabbit IL 8 General Information | |
|---|---|
| Alternate Names | |
| IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP. | |
| Molecular Weight | |
| 11.4 kDa | |
| Chromosomal Location | |
| On chromosome 15 | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | CXCL8 |
| Entrez Gene ID | 100009129 |
| UniProt ID(s) | P19874 |
| COSMIC ID Link(s) | CXCL8 |
| KEGG Gene ID(s) | ocu:100009129 |
| General Description of Recombinant Rabbit IL 8. | |
| IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids – AA 23-101). The IL-8 is expressed in E. Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.