Recombinant SARS SARS MERS Protein

Price range: $ 168.00 through $ 1,748.00

SKU: QP13419
Species: SARS
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Length (Amino Acids):

SKU: QP13419-100ug Categories: , , , , Tag:
 PDF Datasheet

SARS SARS MERS Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant SARS MERS based upon sequence from SARS
Host: QP13419 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of SARS MERS was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13419.
Bioactivity Data: Untested
Amino Acid Sequence: EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Purity: Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant SARS SARS MERS Protein