SARS SARS MERS Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant SARS MERS based upon sequence from SARS
Host: QP13419 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of SARS MERS was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13419.
Bioactivity Data: Untested
Amino Acid Sequence: EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Purity: Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile filtered clear solution.
Recombinant SARS SARS MERS General Information | |
---|---|
Curated Database and Bioinformatic Data | |
UniProt ID(s) | AHC74088 |
COSMIC ID Link(s) | – |
General Description of Recombinant SARS SARS MERS. | |
Recombinant SARS MERS Spike S1 is a peptide from amino acids 56-295 of spike protein S1 produced in E. coli and fused to a 6xHis tag at its C-terminus (UniProtKB accession #AHC74088). SARS MERS is purified by a FPLC using an optimized columns, reagents, and instrument parameters for maximum separation from contaminants . |
Limitations and Performance Guarantee
enQuire Bio’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Reviews
There are no reviews yet.