Recombinant Human Peptide YY Protein

Price range: $ 218.00 through $ 9,999.00

SKU: QP8740
Species: Human
Available Tags: GST
Host: E. coli
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 37

SKU: QP8740-ec-10ug Categories: , , , Tag:
 PDF Datasheet

Human Peptide YY Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Peptide YY based upon sequence from: Human
Host: QP8740 protein expressed in E. coli.
Tag: GST
Protein Construction: A DNA sequence encoding the Homo sapiens (Human) Peptide YY, was expressed in the hosts and tags indicated. Please select your host/tag option, above.
Application Notes: Please contact us for application specific information for QP8740.
Bioactivity Data: Untested
Full Length? Updated: Partial
Expression Region: Updated: Ile31 – Tyr64
Amino Acid Sequence: Updated: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions:
Concentration of Human Peptide YY Protein:
Endotoxin Levels: Not determined.
Buffer: Tris-based buffer, 50% glycerol
Storage Conditions: Store at -20C to -80C.

Limitations and Performance Guarantee

This is a life science research product (for Research Use Only). This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, , , , ,

Tag

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human Peptide YY Protein