AT1:AU2
QP15262, BTLA Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant BTLA based upon sequence from Homo sapiens (Human)
Host: QP15262 protein expressed in Mammalian cell.
Available Tags: C-terminal 10xHis-tagged
Protein Construction: A cDNA sequence encoding the sequence of BTLA was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15262.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 ug/mL can bind Anti-BTLA recombinant antibody(CSB-RA773799MAIHU). The EC50 is 11.56-13.00 ng/mL.
Amino Acid Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYR
Purity: Greater than 95% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.