Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

Price range: $ 208.00 through $ 2,488.00

SKU: QP15208
Species: Human
Applications: WB, ELISA, and others.
Available Tags: Mammalian cell
Available Hosts: His-Flag
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids): 23-328aa(IL12B)&23-219aa(IL12A)

SKU: QP15208 Tag:
 PDF Datasheet
AT1:AU2

QP15208, IL12B&IL12A Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant IL12B&IL12A based upon sequence from Homo sapiens (Human)
Host: QP15208 protein expressed in Mammalian cell.
Available Tags: C-terminal 10xHis-tagged & C-terminal Flag-tagged
Protein Construction: A cDNA sequence encoding the sequence of IL12B&IL12A was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15208.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 ug/ml/mL can bind Anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.
Amino Acid Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Purity: Greater than 95% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Size

1mg, 100ug, 20ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human IL12B&IL12A Heterodimer Protein (Active)