Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)

SKU: QP15259
Species: Human
Applications: WB, ELISA, and others.
Available Tags: E.coli
Available Hosts: His
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids): 1-171aa

This product is currently out of stock and unavailable.

SKU: QP15259
 PDF Datasheet
AT1:AU2

QP15259, MYL12A Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant MYL12A based upon sequence from Homo sapiens (Human)
Host: QP15259 protein expressed in E.coli.
Available Tags: C-terminal 6xHis-tagged
Protein Construction: A cDNA sequence encoding the sequence of MYL12A was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15259.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 ug/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 5.325-6.456 ng/mL.
Amino Acid Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Purity: Greater than 95% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Size

1mg, 100ug, 20ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)