Sale!

Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

Price range: $ 156.80 through $ 1,268.40

SKU: QP15153
Species: Human papillomavirus type 16
Applications: WB, ELISA, and others.
Available Tags: E.coli
Available Hosts: His and His
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 1-98aa

SKU: QP15153 Tag:
 PDF Datasheet
AT1:AU2

QP15153, E7 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant E7 based upon sequence from HHuman papillomavirus type 16
Host: QP15153 protein expressed in E.coli.
Available Tags: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Protein Construction: A cDNA sequence encoding the sequence of E7 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15153.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 ug/mL can bind Biotinylated MYC(CSB-EP015270HU-B), the EC50 is 268.1-354.3 ng/mL.
Amino Acid Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Not test
Buffer: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Size

1mg, 100ug, 20ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)