Recombinant Human Urokinase-type plasminogen activator (PLAU) (Active)

PDF Datasheet

AT1:AU2

QP15280, PLAU Recombinant Protein Product Attributes

Product Type: Recombinant Protein

Recombinant PLAU based upon sequence from Homo sapiens (Human)

Host: QP15280 protein expressed in Mammalian cell.

Available Tags: C-terminal 10xHis-tagged

Protein Construction: A cDNA sequence encoding the sequence of PLAU was constructred and used to recombinantly synthesize the protein.

Recommended Applications: Western Blot, ELISA and others

Application Notes: Please contact us for application specific information for QP15280.

Bioactivity Data: Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug.

Amino Acid Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Purity: Greater than 95% as determined by SDS-PAGE.

Reconstitution Instructions: See COA, sent with protein.

Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.

Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4

Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

Size	1mg, 100ug, 20ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Cookie	Duration	Description
CLID	1 year	Microsoft Clarity set this cookie to store information about how visitors interact with the website. The cookie helps to provide an analysis report. The data collection includes the number of visitors, where they visit the website, and the pages visited.
MR	7 days	This cookie, set by Bing, is used to collect user information for analytics purposes.
sbjs_current	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_current_add	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_first	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_first_add	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_migrations	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_session	1 hour	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
sbjs_udata	session	Sourcebuster sets this cookie to identify the source of a visit and stores user action information in cookies. This analytical and behavioural cookie is used to enhance the visitor experience on the website.
SM	session	Microsoft Clarity cookie set this cookie for synchronizing the MUID across Microsoft domains.
tk_ai	1 year 1 month 4 days	JetPack sets this cookie to store a randomly-generated anonymous ID used only within the admin area and for general analytics tracking.
tk_lr	1 year	JetPack plugin sets this referral cookie on sites using WooCommerce, which analyzes referrer behaviour for Jetpack.
tk_or	1 year 1 month 4 days	JetPack plugin sets this referral cookie on sites using WooCommerce, which analyzes referrer behaviour for Jetpack.
tk_qs	1 hour	JetPack sets this cookie to store a randomly-generated anonymous ID used only within the admin area and for general analytics tracking.
tk_r3d	3 days	JetPack installs this cookie to collect internal metrics for user activity and improve user experience.
tk_tc	session	JetPack sets this cookie to record details on how users use the website.

Cookie	Duration	Description
ANONCHK	10 minutes	The ANONCHK cookie, set by Bing, is used to store a user's session ID and verify ads' clicks on the Bing search engine. The cookie helps in reporting and personalization as well.
MUID	1 year 24 days	Bing sets this cookie to recognise unique web browsers visiting Microsoft sites. This cookie is used for advertising, site analytics, and other operations.