AT1:AU2
QP15342, LTBR Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant LTBR based upon sequence from HMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Host: QP15342 protein expressed in Mammalian cell.
Available Tags: C-terminal 10xHis-tagged
Protein Construction: A cDNA sequence encoding the sequence of LTBR was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15342.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 ug/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 11.83-14.23 ng/ml.
Amino Acid Sequence: SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT
Purity: Greater than 95% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.