Recombinant Rainbow Trout GH Protein

$ 89.00$ 3,600.00

SKU: QP10630
Species: Rainbow Trout
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

SKU: QP10630-2ug Categories: , , , Tag:
 PDF Datasheet

Rainbow Trout GH Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant GH based upon sequence from Rainbow Trout
Host: QP10630 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of GH was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes

Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Bioactivity Data: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Amino Acid Sequence: AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Purity: Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3. Adjusted to pH 8.
Storage Conditions: Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Rainbow Trout GH Protein